SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD004429 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004429
Domain Number 1 Region: 226-600
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.96e-69
Family N-acylglucosamine (NAG) epimerase 0.082
Further Details:      
 
Domain Number 2 Region: 20-163
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.73e-24
Family Thioltransferase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004429
Sequence length 766
Comment 766
Sequence
MSSSGGASSSSSSGERHGVGRSPNRLAAEHSPYLLQHAYNPVDWYPWGEEAFEKARRKDV
PIFLSSMKCHVMEVESFENDEIAKILNDGFVSIKVDREERPDVDKVYMTYVSALYGGGGW
PLSVFLSPNLKPLMGGTYFPPDDKYGRPGFKTILRKVKEAWETKCDALEKTGNVVIKQLR
DALSAKASSQDIPNDLAVVSVDNCVEKTRFKNRDKNNIRSSIADSQLISMQLAGSYDPKF
GGYGSAPKFPRPVENCVMLYKFRKHLESGQVSESQNIMKMITHTLQCMARGGVHDHVGGG
FHRYSVDECWHVPHFEKMLYDQGQIANVYLDTFLITGDEYYSSVARDILDYLRRDMIGEE
GEIYSAEDADSAEYDGAPRKREGAFYVWTNKEIEDTLGENSELFKNHYYVKSSGNCDLSR
MSDPHDEFKGKNVLIERKQASLMASKCGKSVDEYAQILGDCRHKLFDVRSKRPRPHLDDK
FSLVKQSLGCACPYMPEEYLGVAEKAARFIKEKLYDSSSNRLNHSYRNGPAKAPGFLDDY
AFLINGLLDLYEYGGKIEWLMWAAHLQDELFLDKQGGGYFNTPGEDPSVLLRVKEDYDGA
EPSGNSVAAINLIRLSSIFDAAKSDGYKCNVEHLLAVFQTRLRELGIALPLMCCAADMLS
VPSRKQVVLVGNKESTEFRDMVAAAFSTYDPNRTVIQIDPRNTEEMGFWESNNAIIAQMA
RSSPPEKPAVAHVCQDFKCSPPVTSADALRVLLNKTVAAATSSAAA
Download sequence
Identical sequences 39946.BGIOSIBCE004891 OsIBCD004429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]