SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD004514 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD004514
Domain Number 1 Region: 76-233
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.14e-33
Family Glutathione S-transferase (GST), C-terminal domain 0.00052
Further Details:      
 
Domain Number 2 Region: 4-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD004514
Sequence length 243
Comment 243
Sequence
MADPVKLIGAFGSPFVHRVEVALQLKGVAYELIHEDLENKSDLLLASNPIHKKVPVLLHG
GRAICESLVIVEYADDAFDGRPILPADPYDRATARFWAHFIEHKAIYIICSRSSWLALWL
DGEEQEGLLKETKENLALLEAQLHGKRFFAGDSVGYLDIVASGLAHWISVVEEVTGVSLM
GGADEDDEYPALRRWAKEYTSDETEYAADDRIKACLPDRAKLLEHFTAMKEMFMATARSM
AAK
Download sequence
Identical sequences B8A963
39946.BGIOSIBCE004995 OsIBCD004514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]