SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD006515 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD006515
Domain Number 1 Region: 77-295
Classification Level Classification E-value
Superfamily HAD-like 1.14e-42
Family beta-Phosphoglucomutase-like 0.0028
Further Details:      
 
Domain Number 2 Region: 511-843
Classification Level Classification E-value
Superfamily NHL repeat 1.73e-39
Family NHL repeat 0.0035
Further Details:      
 
Domain Number 3 Region: 357-482
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.47e-22
Family Glutathione peroxidase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD006515
Sequence length 1038
Comment 1038
Sequence
MARHLAPPGSFHRLLASRHYPPSSPAPPPRPLLLLPKTLIPPAAAAMEFPRRGRRDVAAA
SAPASSSPETEVAPGAWGKVSAVLFDMDGVLCNSEELSRLAGVDLFAEMGVDVTGDDFVP
YMGTGEANFLGGVAKLKGVKDFNAESAKKRFFEIYLDKYAKPNAGIGFPGALDLVTECKN
AGLKVAVASSADRIKVDANLAAAGLPLSLFDAIVSADAFENLKPAPDIFLAASKTLGVDT
DECIVIEDALAGVQAAKAAEMRCIAVMTTLEEDALQQASPSLIRKNIGDISIRDILYGGS
NAYHKILNGATNAESAPSTNSASSIDDSCEGPCSLYLPKGCLIISRVEIVRYLLVMKDLK
GRVVLLDFWTYCCINCMHVLPDLEFIEKKYKDKPVSFCLLACWTFTVVGVHSAKFDNEKD
LEAIRNAVLRYNITHPVVNDGDMYLWRELGVNSWPTFVVIGPNGKVLAQISGEGHRKDLD
DVVGAALEFYEENKLLQNSSLPLALEKDKDSRLLASPLKFPGKLAIDVLNNRLFISDSNH
NRIVVTNLEGEFICQIGSSEEGLLDGTFDTASFNRPQGLAYNSKKNILYVADTENHALRE
INFVSETVKTLAGNGTKGSDYRGGGQGTNQACFFMVLNSPWDVCYDPSKETLYIAMAGQH
QIWKHNTLDGVTEVLSGDGYERNLNGSSSTRTSFAQPSGISLAPELQELIVADSESSSIR
VVNLKSGGSRSLAGGDPMIPENLFRFGDHDGTGSDVLLQHPLGVVYASDNQIYVADSYNH
KIKRLDPVTRKVTTIAGTGRAGYKDGPALSAQLSEPAGLVEVGDGRLLVADTNNSTIRYI
VLNEKGAEVRTLDLIGVQPPSPKPKTLKRLRRHLSADTDVINIDGGSSIEGYLSLAISVP
DGYHFSKEARSKFDVDIEPADAIEIEPVNGFLNSGQASLKYRRKSSSSSTGRINCKVYYC
KEDEVCLYQSVAFDVKFREEAVPSPAQITLSYSVVPRDTSSSAQLIAAGKNGKCQKGKLF
FGGCLKFQLPLDDVYVVI
Download sequence
Identical sequences 39946.BGIOSIBCE007066 OsIBCD006515

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]