SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD006751 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD006751
Domain Number 1 Region: 70-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.03e-68
Family Glutathione peroxidase-like 0.000000587
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD006751
Sequence length 263
Comment 263
Sequence
MAACCSSLATAVSSSSAKPLAGIPPASPHSLSLPRSPAAAARPLRLSASSSRSARASSFV
ARAGGVDDAPLVGNKAPDFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEI
TAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSF
GVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPA
GWKPGDKSMKPDPKGSKEYFAAI
Download sequence
Identical sequences A0A0E0G7U2 B8AJ36
OsIBCD006751 ONIVA02G21520.1 39946.BGIOSIBCE007314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]