SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007481 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007481
Domain Number 1 Region: 79-236
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.19e-64
Family Glutathione peroxidase-like 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007481
Sequence length 238
Comment 238
Sequence
MPSRTAPFISRLRLLRTAAALSPFSSSAPPRHSPRILRASPVGAPHPPRVSAAVSPLVLP
VAAGFALFSMATAASSAASVHDFTVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYT
ELSQLYEKYKDQGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDNT
APIYKFLKSSKGGLFGDNIKWNFSKFLVDKEGRVVERYAPTTSPLSMEKDIKKLLGSS
Download sequence
Identical sequences A0A0E0GAT7 A2X822
ONIVA02G29430.1 39946.BGIOSIBCE008109 OsIBCD007481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]