SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD007822 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD007822
Domain Number 1 Region: 169-271
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.05e-21
Family Thioredoxin-like 2Fe-2S ferredoxin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD007822
Sequence length 403
Comment 403
Sequence
MADPSRSSPTAAAAGDALLAAAAAPGDAPDATALAVAADADAEFGFQRAELGTEKLAGTV
QFHERHVFLCYKGPEVWPSHVEAAESDRLPRLLAAAIKTHKSDLKKKTKLTICEGEDGTE
SSNGDVLIFPDMIRYRGLTHFDVDNFVQEVLVKDTEWLPGSPEAIKGSYVFVCCHASRDK
RCGVCGPALIKRFKEEIGVQGLADQVSVSACSHVGGHKYAGNVIVFSADAKGEVTGHWYG
YVSPDDVPVLLHKHIGQGEIVDHLWRGQMGLSEEEQRKALESKHVTNGVTEDGAHESPEE
TTNGSACNPVAAGGCCQGNGGFTCCQSDLPKEDKSITAEQNQKSSEKGADKECAAGSKKR
HMKMCSMPTWFETWETADTYAALGIVAAAASVFVAFRIYKNLN
Download sequence
Identical sequences A2X947 Q6Z5K5
OsIBCD007822 39946.BGIOSIBCE008489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]