SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD008091 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD008091
Domain Number 1 Region: 48-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000336
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD008091
Sequence length 146
Comment 146
Sequence
MAAAAALTVLPRAAGVLRLSQHGRSASRLLCAAAGDGEASPAPRAGRLVLYTKPGCCLCD
GLKEKLQAAFLLAGTPYSLASLELQASRLDHERDITTNPDWEQMYQYEIPVLAKVLPDGS
EEKLPRLSPRLSVELVQKKVFSAFDQ
Download sequence
Identical sequences OsIBCD008091 39946.BGIOSIBCE008787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]