SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD008773 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD008773
Domain Number 1 Region: 85-217
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.39e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.00061
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000101
Family Glutathione S-transferase (GST), N-terminal domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD008773
Sequence length 225
Comment 225
Sequence
MAAGLQVFGQPASTDVARVLTCLFEKNLEFELIRIDTFKKEHKLPEFIKLRDPTGQVTFK
HGDKTLVDSRTICRYLSTQFPDDGNRTIYGTGSLERASIEQWLQAEAQSFDAPSSELVFH
LAFAPQLNIPADEARIAENERKLQQMLNVYDEILAKNKYLAGDEFTLADLSHLPNSHYIV
NARSPRGKKLFTSKKHVARWYEEISNRASWKQVVKMQSEHPGAFE
Download sequence
Identical sequences A0A0E0GGE2 A2XC67
39946.BGIOSIBCE009550 ONIVA03G02370.1 OsIBCD008773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]