SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009707 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009707
Domain Number 1 Region: 109-231
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.98e-19
Family Glutathione S-transferase (GST), C-terminal domain 0.0045
Further Details:      
 
Domain Number 2 Region: 23-113
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009707
Sequence length 259
Comment 259
Sequence
MAAAAAAPASSEKEVLPPSLTSSSEPPPLFDGTTRLYVAYHCPYAQRAWIARNYKGLQDK
IKIVAIDLADRPAWYKEKVYPENKVPSLEHNNQVKGESLDLVKYIDTNFEGPALLPDDSE
KQQFAEELLAYTDAFNKASYSSIVAKGDVSDEAVAALDKIEAALSKFNDGPFFLGQFSLV
DIAYVPFIERFQIFFSGIKNYDITKGRPNLQKFIEEVNKIHAYTETKQDPRLPEDVTKDE
PTTTCDGDRELVQYIVDKD
Download sequence
Identical sequences B8ALI5
OsIBCD009707 39946.BGIOSIBCE010633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]