SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD009708 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD009708
Domain Number 1 Region: 108-240
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.12e-20
Family Glutathione S-transferase (GST), C-terminal domain 0.0028
Further Details:      
 
Domain Number 2 Region: 27-112
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.04e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD009708
Sequence length 255
Comment 255
Sequence
MAAAAAPRSSGKEALPAALGSASEPPRLFDGTTRLYICYFCPFAQRAWITRNFKGLQDKI
ELVGIDLQDKPAWYKEKVYEQGTVPSLEHNGKIMGESLDLIKYIDSHFEGPALLPEDPEK
RQFADELIAYANAFTKALYSPLISKADLSAETVAALDKIEAALSKFGDGPFFLGQFSLVD
IAYVTIIERIQIYYSHIRKYEITNGRPNLEKFIEEINRIEAYTQTKNDPLYLLDLAKTHL
KARPLPETNAQPPQL
Download sequence
Identical sequences A0A0D9Z5L2 A2XFB0
OGLUM03G13030.1 OsIBCD009708 39946.BGIOSIBCE010634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]