SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD010504 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD010504
Domain Number 1 Region: 383-487
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.82e-25
Family Glutathione peroxidase-like 0.00064
Further Details:      
 
Domain Number 2 Region: 42-153
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.83e-24
Family Glutathione peroxidase-like 0.00021
Further Details:      
 
Domain Number 3 Region: 516-576
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.37e-16
Family C1-like domain 0.00046
Further Details:      
 
Domain Number 4 Region: 200-309
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000599
Family Glutathione peroxidase-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD010504
Sequence length 601
Comment 601
Sequence
MADAAGIATVLAADGRDFLLRNSADQLPATRAAVRCCAIEMSHEKVKISSIEASTVALYF
SASWCPPCRRFTPKLIEAYNELVSQGKNFEVVFVSGDKDQEAFDAYFAKMPWLAVPFSDS
ECRAKLNKRFKVRGIPHLVILNATSGEVYTEDGVELVTVHGTEAYPFTTERINELKEQEK
AAKDNQTVQSVLGTPTRDYLLSNKGDRVPISDLEGKYVGLCFVVNGYGPVVQFTSLLAKF
YEKLKEVGEKFEVVAVSLDSDEELSNESFAGMPWLAIPQEDKMGEKLARYFELRGLPTLV
LIGPDGKTLNNNVADIIDEHGQDAWEGFPFTAEKMEILAEKAKAKAELQTLESLLVIGDL
DFVLGKDGAKYLMKINICYFNAKVPVSELVGKTVLLYFSAKWCGPCRAFLPKLVDEYNKI
KEKHNDFEIIFISSDRDQSSYDEFFSGMPWLALPLGDERKQHLSKTFRVRGIPSLVAIGA
DGRTVARDAKTPLTAHGADAFPFTEERLLEMERKIDEMAKGWPGKLKHELHDEHELVLTR
CTTYGCDGCDEMGSSWSYRCRECDFDLHPKCALGKEEEKKGDDEAEAEADPACEGGVCRK
A
Download sequence
Identical sequences 39946.BGIOSIBCE011494 OsIBCD010504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]