SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD010669 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD010669
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 6.36e-18
Family Pyruvate phosphate dikinase, N-terminal domain 0.0000831
Further Details:      
 
Domain Number 2 Region: 68-108
Classification Level Classification E-value
Superfamily Phosphohistidine domain 0.0000785
Family Pyruvate phosphate dikinase, central domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD010669
Sequence length 111
Comment 111
Sequence
MQDIEFTVQENRLWMLQCRTGKRTGKGAVKIAVDMVNEGLIDRRSAIKMVEPRHLDQLLH
PQFESPSSYGDKVIATGLPASPGAAVGQIVFTADDAEAWHAQGKSVILYSP
Download sequence
Identical sequences 39946.BGIOSIBCE011660 OsIBCD010669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]