SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD011053 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD011053
Domain Number 1 Region: 76-229
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 7.5e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.00033
Further Details:      
 
Domain Number 2 Region: 5-104
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.18e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011053
Sequence length 243
Comment 243
Sequence
MANLVKLIGAFGSPFVHRAEVALRLKGVAYEFIHEDLNNKSDLLLAKNPIHKKVPVLLHG
DRAVCESLVIVEYIDEAFNGPPLLPADPYHRAMARFWAHFIDHKAIFSCHSFKSYVSTRP
SWLALWLEGEEQKGFLKETKENLALLEAQLGGKRFFAGDSIGYLDIAAGGLAHWVGVLEE
VTGVSLVAGDDGDDEYPALRRWTNEYTANDAVKLCLPNRERIAAFFTPKDKYKIMARAML
RQQ
Download sequence
Identical sequences A0A0E0NXU8
39946.BGIOSIBCE011974 OsIBCD011053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]