SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD011865 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD011865
Domain Number 1 Region: 83-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000992
Family Glutathione peroxidase-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD011865
Sequence length 258
Comment 258
Sequence
MAAAAASTSLPVPRVSLPPSARPAAAPRHGLLIPGRRGCFRLRGSPAAPAAAASGSPSVP
SSSPEAGSGIGDALGGVAIYSAATGEPVLFRDLWDQNEGMAVVALLRHFGCPCCWELASV
LRDTKERFDSAGVKLIAVGVGTPDKARILAERLPFPLDYLYADPERKAYDLLGLYFGIGR
TFFNPASASVFSRFDSLKEAVKNYTIEATPDDRASVLQQGGMFVFRGKELIYARKDEGTG
DHAPLDDVLNICCKAPAA
Download sequence
Identical sequences A2XLM8 I1PF32 Q851F6
LOC_Os03g51950.1|13103.m05658|protein ORGLA03G0297800.1 OsIBCD011865 XP_015628233.1.37577 39946.BGIOSIBCE012842 39947.LOC_Os03g51950.1 LOC_Os03g51950.1|PACid:21915209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]