SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD012661 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD012661
Domain Number 1 Region: 65-164
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.75e-34
Family Thioltransferase 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD012661
Sequence length 168
Comment 168
Sequence
MAATAAASVAAISPLPGASLPRPVSARVPLLPRASPPTWRLSVGSARARSARCLAAAGGG
GLAPEMRATLDKVVGSHKVVLFMKGTKDFPQCGFSHTVVQILRSLDVPFETLDVLANEAL
RQGLKEYSSWPTFPQLYIDGEFFGGCDITVDAYKSGELQETLEKAMLS
Download sequence
Identical sequences B8ANP8
39946.BGIOSIBCE013712 OsIBCD012661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]