SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD013391 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  OsIBCD013391
Domain Number - Region: 92-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0373
Family Glutathione S-transferase (GST), N-terminal domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD013391
Sequence length 146
Comment 146
Sequence
MRSIRAAQALASRSLLLSSRALHGDAASTAAAAAGGGRLGVQPSPPSQASSSSSSRAMPA
GIAGAVSFSLTFATMAAAEAKERPPMDLLPQNVVLYQYQACPFCNKLNVEYIPLNPYVSI
DYPGFNAKSTAENAPRLIAQRLDDQC
Download sequence
Identical sequences OsIBCD013391 OsIBCD013392 39946.BGIOSIBCE014366 39946.BGIOSIBCE014367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]