SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD013393 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD013393
Domain Number 1 Region: 30-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000366
Family Glutathione S-transferase (GST), N-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD013393
Sequence length 104
Comment 104
Sequence
MASAKLHLVSPSPTNLHSNLIHWQHDVIIYSFLDYHDIPYKVVEVNPLSKKEIKWSEYKK
VPILTVDGEQLVDSSDIINILQQRVRPDDKATNEEEEKWRRSWF
Download sequence
Identical sequences OsIBCD013393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]