SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD013526 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD013526
Domain Number 1 Region: 30-262
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.76e-66
Family Carbonic anhydrase 0.0000163
Further Details:      
 
Domain Number 2 Region: 257-353
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.18e-16
Family Thioltransferase 0.019
Further Details:      
 
Weak hits

Sequence:  OsIBCD013526
Domain Number - Region: 359-408
Classification Level Classification E-value
Superfamily DnaJ/Hsp40 cysteine-rich domain 0.027
Family DnaJ/Hsp40 cysteine-rich domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD013526
Sequence length 409
Comment 409
Sequence
MAASHGNAIFVLLLCTLFLPSLACDSGGVKFGYTGSIGPDFWGNLSADFTRCSNGKQQSP
IDIDTNNLVHELNMEPLHRNYTAANATLVDNIFNVALRYEEAAGVLSINGVKYTLKQMHW
HSPSEHTINGFRFPLELHMVHTNENGNITVLAFLYRFGRPDPFFEQIQDKLAALNAEGCK
AEKGSPVPAGSVSLLTMRQHVHIYYRYVGSLTTPPCAENVIWNIPAMPREMTPQQAADLM
APLDEGYRRNSRPTQQMNGRTVQLYHRFWGKKKRRSSPTFEECNAVRAAIEAHDVKLIER
DVSMDSGYREELRLLLGGREVRVPAVFVRGRHVGGAAEVTKLEEEGKLKALLQGLPRARV
WCAGCAGVRFVMCRDCNGSRKVRVDGERKETVQCGECNENGLVRCPICS
Download sequence
Identical sequences OsIBCD013526 39946.BGIOSIBCE014435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]