SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD013937 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD013937
Domain Number 1 Region: 83-182,214-243
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.49e-27
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 
Domain Number 2 Region: 574-689
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000000049
Family Protein kinases, catalytic subunit 0.034
Further Details:      
 
Domain Number 3 Region: 517-575
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000352
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 
Weak hits

Sequence:  OsIBCD013937
Domain Number - Region: 396-439
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000145
Family Pan module (APPLE domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD013937
Sequence length 703
Comment 703
Sequence
MPMEASLNVWVGMLSVHVFIGLLLLSLHAPPYSAAVDDTLAAGQVLAVGEKLVSRNGKFA
LGFFQPSAIAISKSSNYTNALGWYLAIWFNKIPVFTTVWVANRERPITVPRLNSTWLKMS
GDGNLYILDHATNSIIWSTDHVVNTTTETGMNTSATLLNSGNLVIRNPSGVVSWQSFDNP
TDVVLPGAKFGWNKATGLNRLGISKKSLIDPGLGSYSVELDTTGARGLILKHRNPSMEYW
SSDRALIIPVLKSLFEMDPRTRGLITPAYVDNSEEEYYIYTMSDESSSVFVSLDVNGQIK
MYVWSRANQSWQSIYAQPVDPCTPSATCGPFTICNGNSTQTCDCMESFSVKSLWDWELDD
RTGGCIRDTPLHCVSDKNMTSSTDMFQPIGLVTLPYDPQIMQDATTQGECAQACLSDCSC
TAYSYQNSRCSVWHGKLLNVNKNDGIYINADNVLHLRLAATDFQDLSKNKRKTNVELVVG
ASIVSFVLALIMILLMIRGNKFKCCGAPFHDNEGRGGIIAFRYTDLAHATKNFSEKLGAG
GFGSVFKGVLTDMATIAVKKLDGAHQGEKQFRAEWISGVAITPKVDVYSFGMVLFEIISG
RRNSPEVHTSGNYDATYFPVRAINKLHEGDMSSLVDPRLHGDYNLDEVVRVCKVACWCIQ
DDEFDRPTMREVVRVLEGLQELDMPPMPRLLATLTNFSAVASM
Download sequence
Identical sequences 39946.BGIOSIBCE014765 OsIBCD013937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]