SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD014362 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD014362
Domain Number 1 Region: 66-175
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.88e-32
Family Thioltransferase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD014362
Sequence length 179
Comment 179
Sequence
MAAAATATATACPAPPPPRSLYRGVALAAPGRRRAGYGASSSAARRWPGCRRRWAAHRIR
TVSCAYSPRGAETITACSWNEYVICSDIPVLIEFWASWCGPCRMVHRIVDEIAQEYAGRI
KCYKLDTDDYPQVATSYSIERIPTVLLFKDGEKTHSITGTLPKAVYVRAIEKSISDSEQ
Download sequence
Identical sequences B8ATZ4
OsIBCD014362 39946.BGIOSIBCE015220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]