SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD014378 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD014378
Domain Number 1 Region: 37-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.5e-30
Family PDI-like 0.0066
Further Details:      
 
Domain Number 2 Region: 256-367
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000783
Family Calsequestrin 0.043
Further Details:      
 
Weak hits

Sequence:  OsIBCD014378
Domain Number - Region: 197-260
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0151
Family Glutathione peroxidase-like 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD014378
Sequence length 421
Comment 421
Sequence
MAATTTTRPLPLLLLLLLPPLLLLLLSFHAAAAAEEFPRDGRVIELDESSFEAALGAIDY
LFVDFYAPWCGHCKRLAPELDEAAPVLAGLSEPIIVAKVNADKYRKLGSKYGVDGFPTLM
LFIHGVPIEYTGSRKADSLVRNLNKFVAPDVSILESDSAIKSFVENAGTSFPMFIGFGVN
ESLIAGYGGKYKKRAWFAVAKDFSEDFMVTYDFDKVPALVSLHPKYKEQSVFYGPFEGSF
LEDFIRQSLLPLTVPINTETLKMLDDDDRKVVLAILEDDSDETSSQLVKVLRSAANANRD
LVFGYVGIKQWDEFVETFDISKSSQLPKLIVWDRNEEYEVVEGSEKLEEGDQASQISQFL
EGYRAGRTTKKKVSGPSFMGFLNSLVSLNSLYILICVFALLGVMIYFTGQDDTPQCFSTL
D
Download sequence
Identical sequences A2XTL5
OsIBCD014378 39946.BGIOSIBCE015236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]