SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD014403 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD014403
Domain Number 1 Region: 355-463
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.95e-29
Family PDI-like 0.0013
Further Details:      
 
Domain Number 2 Region: 28-162
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.53e-25
Family PDI-like 0.00095
Further Details:      
 
Domain Number 3 Region: 171-265
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000748
Family PDI-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD014403
Sequence length 495
Comment 495
Sequence
MAVNLVLSFALAILISSSPTAVGVDATEELKEAVLTLDAGNFSEVVAKHPFIVVKFYAPW
CGHCKQLAPEVTDYFDTFSSQHHGRFNIKYEKAASILRKNELPVVLAKVDAYNERNKELK
DKYGVYSYPTIKIMKNGGSDVRGYGGPREADGIVEYLKRQVGPASLKLESAEEAAHSVVD
KGVILVGVFPEFAGMEYENFMVVAEKMRADYDFFHTSDASILPRGDQSVKGPIVRLFKPF
DELFVDSEDFGKDALEKFIEVSGFPMVVTYDADPTNHKFLERYYSTPSSKAMLFVSFGDD
RIESFKSQIHEAARKFSGNNISFLIGDVADADRVFQYGNLTPYVKSEPIPKVNDQPVKVV
VADNIDDIVFNSGKNVLLEFYAPWCGHCRKFALILEEIAVSLQDDQDIVIAKMDGTVNDI
PTDFTVEGYPTIYFYSSSGNLLSYDGARTAEEIISFINENRGPKAGAAAAVDEKTQIDAV
EEEVTSSSEPVKDEL
Download sequence
Identical sequences OsIBCD014403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]