SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD015215 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD015215
Domain Number 1 Region: 9-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.15e-63
Family Glutathione peroxidase-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015215
Sequence length 168
Comment 168
Sequence
MAAAPSATSVHDFTVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYTELSQLYEKYK
VQGFEILAFPCNQFGGQEPGSNEEIVQFACTRFKAEYPIFDKVDVNGNNAAPLYKYLKSN
KGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
Download sequence
Identical sequences B8ASV8
OsIBCD015215 39946.BGIOSIBCE016169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]