SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD015520 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD015520
Domain Number 1 Region: 190-300
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.05e-25
Family Glutathione peroxidase-like 0.00078
Further Details:      
 
Domain Number 2 Region: 16-128
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.64e-20
Family Glutathione peroxidase-like 0.00065
Further Details:      
 
Domain Number 3 Region: 337-382
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000164
Family C1-like domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015520
Sequence length 448
Comment 448
Sequence
MGETAEGVEAGEKYVSIPQLAGVGTLLSNGGKEIPLSSIEGKRICLFFSAHWCRPCRNFT
PKLLQIYRKLRNTCKNMEIIFISLDRDEISFLDYFKGMPWLALPFDTGLRQKLCVQFDIE
HIPALIPLSTTLSHGFRVEEDAVKLVEEYGVDAYPFGAKRRSELEGMDDARRQGGNLLQL
LGCKEREYVISADGIKTPISDLNGKTIGLYFGAHWCPPCRAFTKQLREAYDELKALRPGN
FQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTVQELSRIFTIKGIPTLLILGPDGKVFK
TDGRRIISKYGAMAFPFTESRAYELEEVLKKERDSLPHRVRDHRHEHELELDMAKAYVCD
ECQQKGQNWVFSCKQCNFDLHPTYLNNLYSDPKHLPQLHKHFDQSNVATAENSLRFLNGE
PENSDISSIHVAFADLAGKIRGEDDKRD
Download sequence
Identical sequences B8ATV8 B9FCE3
OsIBCD015520 39946.BGIOSIBCE016512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]