SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD015707 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD015707
Domain Number 1 Region: 471-642
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-50
Family Protein kinases, catalytic subunit 0.00048
Further Details:      
 
Domain Number 2 Region: 70-189
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-26
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Domain Number 3 Region: 663-731
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-16
Family Protein kinases, catalytic subunit 0.0054
Further Details:      
 
Weak hits

Sequence:  OsIBCD015707
Domain Number - Region: 355-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00569
Family Hairpin loop containing domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD015707
Sequence length 796
Comment 796
Sequence
MEAATANIFHLSLTFFFMVLLTLGTSAAGVASDTLSNGRNLTDGNTLVSAGGSFTLGFFS
LGLPSRRYLAIWFSESADAVWVANRDSPLNDTAGVLVNNGAGGLVLLDGSGRAAWSSNTT
GKSSSATAAQLLESGNLVVRERDQLNTGVFIWQSFDHPSNTLIAGMRLGNNRQTGDAWFL
SSWRAHDDPATGDCRRVLDTRGLPDCVTWCGGAKKYRTGPWNGQWFSGVPEMASYESIFS
SQVVVTPDEIAYVFTAAAAAGSPFSRLVLDEAGVTERLVWDPSSKVWIPYMKAPRGVCDD
YAKCGAFGLCNEDTASTLFCSCMAGFSPVSPSRWSMRDTSGGCRRNAPLECGNGSTTDGF
VTVRGVKLPDTDNATVDTGATLDECRARCLANCSCVAYAAADISGRGCVMWIGDMVDVRY
VDKGQDLHVRLAKSELVLSGKRHQNKVVQKRGILGYLSASNELGDENLELPFVSFGEIAA
ATNNFSDDNMLGQGGFGKVYKGMLDDGKEVAIKRLSKGSGQGAEEFRNEVVLIAKLQHRN
LVRLLDHANKYVLDWPTRFKIIKGVARGLLYLHQDSRLTVIHRDLKPSNILLDVDMSPKI
SDFGMARIFGGNQHEAILTELLEHIKSDTYSFGVILLEIVSCLKISLPRLTDFPNLLAYG
MLGGNKEVAIKRLSKHSGQGVEEFRNEVVLIAKLQHKNLVRLLGCCIHGEEKLLIYEYLP
NKSLDYFLFGLLCVQEDPNARPLMSSVVAMLENEATTLPTPKQPAYFVPRNCMAGGARED
ANKSVNSISLTTLQGR
Download sequence
Identical sequences B8AUV5
OsIBCD015707 39946.BGIOSIBCE016724

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]