SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD016814 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD016814
Domain Number 1 Region: 284-479
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-26
Family Thioltransferase 0.0062
Further Details:      
 
Domain Number 2 Region: 19-351
Classification Level Classification E-value
Superfamily TPR-like 2.91e-25
Family Tetratricopeptide repeat (TPR) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD016814
Sequence length 481
Comment 481
Sequence
MSAAASAEAEEVRRAGNEQYKNGCFEEALRLYDRALALCSDSAACRANRAAALIGLSRLG
EAVAECEEAIRLDPSYGRAHQRLASLQIRLGRTADARKQIGMGGLQPDVVELHKLEAVEK
HLGRFADARKIGNWKSALRECNAAIAAGADSCAMLFASRAEALLQINQLDEADLAISRAS
KLDCSSSCSQDMMLCGFQSNSYLYYVHAQVEIAFGRFDSAMSSMEKARKIDSGNVEVMAM
HKNVRTVAQARTLGNELFHSGKFAEAFLAYGEGLKHHPANSVLYCNRAACMFKLGQWEKS
IEDCNEALKIQPNYWKALLRRAASYGKIEQWADSVKDYEVLRRELPGDTEVAEGHFHALV
ALRSSRGEDVSNMKFGGEVEALVGAEQFQMATTLPGVSVVHFMAPLNQQCSDIAPFVDAL
CTRYPSVNFLKVDITENPTVTQLENVKTVPTFKIYKDGTRVMEMICPSHQLLESSLRQYE
V
Download sequence
Identical sequences B8AZ67
OsIBCD016814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]