SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD017831 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD017831
Domain Number 1 Region: 313-702
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 5.56e-98
Family Regulator of chromosome condensation RCC1 0.00066
Further Details:      
 
Domain Number 2 Region: 70-173
Classification Level Classification E-value
Superfamily PH domain-like 2.54e-25
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 3 Region: 701-770
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.25e-16
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.002
Further Details:      
 
Weak hits

Sequence:  OsIBCD017831
Domain Number - Region: 914-976
Classification Level Classification E-value
Superfamily Tropomyosin 0.0242
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD017831
Sequence length 1385
Comment 1385
Sequence
MSDASSDLAGARPGAVERDIEQVSRFPILRLARLGNAEEIPAVGVFLVSGPRVAGKASLD
GCMIELGVAITALKKGAYLLKYGRRGKPKFCPFRLSNDESILIWFSGKEEKQLRLSHVSR
IIPGQRTAIFQRYPRPEKECQSFSLISHDRSLDIICKDKDEAEVWFAGLKTLITRSHQRK
WRTESRSDMLSSGTTSPRTYTRRSSPLSSPFSSNDSVHKDGGENYRLRSPFGSPPKVGLE
KAFSDIVSYAAPPKPFFPSDSNAGSVHSVSSGQSDNTNLHSRGIPMDAFRVSLSSAVSSS
SHGSGHDDGDALGDVFIWGEGTGEGILGGGNSRVGNSGVKMDCLIPKPLEFAVKLDVQNI
SCGGRHATLVTKQGEIYSWGEESGGRLGHGVDCDVPQPKLIDALANMNIELVACGEYHTC
AVTLSGDLYTWGNGTSNSGLLGHGNEVSHWVPKRVNGPLEGIHVSAISCGPWHTAIVTSA
GQLFTFGDGSFGVLGHGDRQSLSVPREVESLKGLRTVRAACGVWHTAAVVEVMVGNSSSS
NCSSGKIFTWGDGDKGRLGHGDKDTRLVPTCVAALVEPNFCQIACGHCMTVALTTSGHVY
TMGSPVYGQLGNPQADGMLPVRVEGKLHKNFVEEISCGAYHVAVLTSRTEVYTWGKGANG
RLGHGDTDDRSSPTLVESLKDKQVRTVVCGINFTAAICIHKWVSGVDQSMCSGCRLPFNL
RRKRHNCYNCALVFCHACSSKKSLKASLAPNPNKPYRVCDSCYSKLNKGPETDRYSSAKR
GSVIQGFNDSVDEELETKSNAQLSRLSSLESFKHMDSRTSKKNKKFEFNSSRVSPIPNGS
SHWSGLNISKSFGSSKKFFSASVPGSRIVSRATSPVSRRASPPRSTTPTPTLGGLTSPRV
VDGVKPNDSISQEVLSLRSQVENLTRKSQLLEADLERTTKQLKEAISIAGEETAKCKAAK
EVIKSLTAQLKGMAEKLPEGAGLVKNSRLPPLPGISIPTDISVASESLGSPRSSGEPCSN
GSNGLLVSNGPTSVRNKLSHPEIPKNGTRLPDSDSKHESEWVEQDEPGVYITLTALPGGT
RDLKRVRFRNLRLCPPFLETAGSVSARHKQNNGGKRIGHGLRCKVALKDLSFVLADLSAC
FGENFMPITLLPQIERHLSNLHGLDEHLAKGGGIPQQYPQEGYHAQNSSHCWPKIVVTVG
PKKPWAKISLGTPTTLPSWSVAQSETTIQTSVAHGLRHTRPTPLRQPASSPANDKTATTP
VTLASALTQATFTTPPAGFPVESDLWEPAQGTTLPRQSEFSLLTDHRLQSAKKLPTKKGR
SSLAGRPSPPSCLKAPHKEGEELPKHSGSLANHKEDDPVAKLTGGLADASAPLPPRSSPT
ATRAT
Download sequence
Identical sequences B8AXT1
39946.BGIOSIBCE018861 OsIBCD017831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]