SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD018332 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD018332
Domain Number 1 Region: 68-158
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.74e-19
Family Thioltransferase 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD018332
Sequence length 220
Comment 220
Sequence
MWASWDLQSLLVPPDAALSSSSPSPPRVFHRIRVAACALRVLRNLQSAGQQQQPHAAAAI
WSEPGGGEGARVVLYYTSLRVVRGTYEDCRAVRAILRGLRAAVDERDLSMDPAFLPELAA
LLPHRRHLALPQVFVNGRHLGGAEEVRRLHESGELRRIVAAANPTPASCGRCAGERYVLC
GSCDGSHKRYSHKGGGGFRACAMCNENGLVRCPDCCLPPA
Download sequence
Identical sequences A2Y5M9
39946.BGIOSIBCE019375 OsIBCD018332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]