SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD018560 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD018560
Domain Number 1 Region: 49-225
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-50
Family NQO2-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD018560
Sequence length 255
Comment 255
Sequence
MLPPAARLAARRLLGLATSSASDSAAARRLSRSPHLDSPENNPDMPWEFTEANMKKVNEI
LSHYPSNYKQSGIIPMLDLAQQQHGGWVPVAAMNAIAKIVEVAPIRVYEVATFYTMFNRT
KVGKYHLLVCGTTPCMIRGSREIEEALLEHLGVKRNEVTSDGLFSVGEMECMGCCVNAPM
IAVADYSKGSEGYTYNYYEDLTPKRVVEIVEMLKRGETPPRGTQHPERKNCGPAGGNTTL
HGEPKPPPCRDLDAC
Download sequence
Identical sequences OsIBCD018560 39946.BGIOSIBCE019630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]