SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD018818 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD018818
Domain Number 1 Region: 46-143
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.18e-18
Family PDI-like 0.02
Further Details:      
 
Domain Number 2 Region: 295-339
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 0.000000144
Family FAD-dependent thiol oxidase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD018818
Sequence length 448
Comment 448
Sequence
MAAAAVARRVVLVLVLAAASLAAAPRGAAARSLGGREGPGEVDADAAVDLNATNFDAFLK
ASLEPWAVVEFFAHWCPACRNYKPHYEKVAKLFNGRDAAHPGLILMARVDCASKVNIDLC
NRFSVDHYPFLLWGPPTKFASAKWDPKQENNEINSFSLEDKKYENENMLPKNASDPEQIV
QAIYDVEEATAQALQIILERKTIKPKNRDSLIRFLQILVARHPSKRCRRGSAELLINFDD
HWSLNLSLSSQEGSKLLESVAEENHWICGKEVPRGYWLFCRGSKSETRGFSVSAPFRTAR
ELSLWLWSTHNKVNMRLMKEEKDMGTGDPLFPKVTWPPNQLCPSCYRSSKVTDGAVDWNE
DAVYQFLVNYYGKKLVSSYKETYMESLQQQEKKIVSEDSSISNAASVPIGAALGVAIASC
TFGALACFWRAQQKNRKYSHHLRSLKKI
Download sequence
Identical sequences 39946.BGIOSIBCE019937 OsIBCD018818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]