SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019044 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019044
Domain Number 1 Region: 468-578
Classification Level Classification E-value
Superfamily TPR-like 1.42e-26
Family Tetratricopeptide repeat (TPR) 0.00089
Further Details:      
 
Domain Number 2 Region: 223-390
Classification Level Classification E-value
Superfamily TPR-like 6.27e-25
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 602-685
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000784
Family Thioltransferase 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019044
Sequence length 705
Comment 705
Sequence
MSGADRLSIRAAALALDDAAAGRDKPDTKRDVFADLGSPVSPLRLRPGGAAATPSSSSSS
AGSAKSPALCNAGAGVGRGGGGGRGSHSGELVAEGNPPRPPGHRRSGSGPLIFSGGSSSA
GSGGGGGGCGGGSTASSPLTNALPTGNICPSGRVASAAPAPPRRARPDVLGSGTGHYGHG
SIMRGGGGMTPPRSSIDASPYHGSYSRSPAPQGSSGGLQEVTRAGNEWYKKGHYGEALRH
YDQAVALCPDSAACRSNRAAALIGLGRLAEALRECEEAIRRDPASGRAHSRLAALCLRFG
MVERAREHFMLAGQVNQSDPAEFQRLQEVERHLGRCMDARKTGDWKSALREADAAIANGA
DSSQLLLALRSEALLRLNKLEEADSTITSLSKLDIASLSSMSTKLSGMVADSYVHVVEAQ
VNMAFGSKTSTEVYSCRFDIAVTMAEKARVIDPGNTEVGRITNNIRLVAQARGQGNELFK
AGKFAEASLAYGEGLKYEPSNPVLYCNRAACWSKLGRWMKAVEDCNEALKVHPGYTKALL
RRAASYAKLERWADCVRDYEVLRKELPNDTEVAEALFHAQVALKTARGEEVANMKFGGEV
ETITSIEQLRDAIHSPGVSVVYFMATMNQQCQQITPSVDSLCSECPSVNFLKVNVDESPM
VARAENVRIVPSFKIYKDGARMKEMICPSLHILRYSVKHYAVSSS
Download sequence
Identical sequences A0A0E0PRX0
39946.BGIOSIBCE020216 OsIBCD019044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]