SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019645 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019645
Domain Number 1 Region: 74-223
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.39e-56
Family Glutathione peroxidase-like 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019645
Sequence length 230
Comment 230
Sequence
MASTTAAAARFTCLAPATRPASASAGRFLLPAQHWGAATAHGSSAAVPVPVVAAAPSRRW
APGVTYATAATGKSVHDFTVKDIDGKDVALSKFKGRALLIVNVASQCGLTTANYTELSHL
YEKYKTQGFEILAFPCNQFGAQEPGSNPQIKQFACTRFKAEFPIFDKVDVNGPNTAPIYK
FLKSSAGGFLGDLVKWNFEKFLVDKTGKVVERYPPTTSPFQIEVLMVKQP
Download sequence
Identical sequences A2YA34
OsIBCD019645 39946.BGIOSIBCE020915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]