SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019883 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019883
Domain Number 1 Region: 353-440
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.01e-20
Family DEP domain 0.0048
Further Details:      
 
Domain Number 2 Region: 231-321
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.91e-17
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019883
Sequence length 711
Comment 711
Sequence
MENGDKDEKNVAVTEGSTNSEEKDQDEDLLRRTEMLNAKEAINSSNENSGNDSEAQIHVR
DDSQKEFNEKMNKEGSSDPMEPTDSSQTEEDILAEDKSEEPVFDGTEVAEMEDLRRSSNQ
SVELDSDAHGSVLNERATAIKNFVKEKGAIAVSTFIRRLSGKKDENEFSVEDEKNEGSES
ISSGNIGSDAEPKSKEVQPKSEERTTWNPLNLIKIGRDFDTFMTGEAGHENVPDLIEQPT
GKGRIIIYTKLGCEDCKMVRSFMRQKMLKYVEINIDIFPSRKMELENNTGSSTVPKVYFN
DLLIGGLTELKKMEESGILDDRTDALFKDEPSSAAPLPPLPGEDDESGSGKIDELATIVR
KMRESITLKDRFYKMRRFSSCFLGSEAVDFLSEDQYLERDEAVEFGRKLASKYFYRHVLD
EDVFEDGNHLYRFLDNDPIIMSQCYNIPKGIIDVEPKPIVEVASRLRKLSETMFEAYVSE
DGKHVDYRSIQGCEEFKRYVRTTEELQRVETHELSREEKLAFFINLYNMMAIHALVTCGH
PAGPLDRRKFFGDFKYVIGGCAYSMSAIQNGILRGNQRPPYNLAKPFGQKDQRSKVALPY
AEPLVHFALVCGTKSGPALRCYSPGNIDKELVEAARDFLRNVGIVVDPEAKVASVSKILR
WYSTDFGKNETEVLKHAANYLEPAESEQFLELLANTQLKVLYQPYDWSLNI
Download sequence
Identical sequences B8B477 Q67UI1
LOC_Os06g12030.1|13106.m01305|protein LOC_Os06g12030.2|13106.m01307|protein OsIBCD019883 XP_015644373.1.37577 XP_015644374.1.37577 39946.BGIOSIBCE021182 39947.LOC_Os06g12030.2 LOC_Os06g12030.1|PACid:21929558 LOC_Os06g12030.2|PACid:21929559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]