SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019927 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019927
Domain Number 1 Region: 12-86
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.48e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019927
Sequence length 164
Comment 164
Sequence
MEVVGGIGCQFTLRRAILGPFTQRVLLTIEEKHLPYDIKLVDLANKPDWFLKISPEGKVP
IVKLEEQWVADSDVITQAIEEKYPEPSLATPPEKASVGSKIFSTFIGFLKSKDPNDGTEQ
ALLSELTSFDSYLKDNTIFSMDSFVKTIALQEDVIAGWRPKVMG
Download sequence
Identical sequences 39946.BGIOSIBCE021233 OsIBCD019927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]