SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD019933 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD019933
Domain Number 1 Region: 454-740
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.6e-95
Family Motor proteins 0.00000308
Further Details:      
 
Domain Number 2 Region: 12-123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.96e-17
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Weak hits

Sequence:  OsIBCD019933
Domain Number - Region: 235-276
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.0288
Family EB1 dimerisation domain-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD019933
Sequence length 863
Comment 863
Sequence
MGSVDGDFEGLQAADRRAEVIEWLNALLPEYCLPLDSSDDELRELLSDGKVLCHIVNALI
PGVLEESWGAYASSDQHAGHVKKFLAVVADMGLPGFSVKDLEEGSMSGVVDCLLVLRESV
SSGLRDGTSKAPLRKKWRVPETGEPLVPGVAQGKTSPGEDKRNGLPDPKSQQKTPIFNVI
TFSQNAPTQSLLSVVNGILDESIERKKGEIPHRVVYLLRKVVQEIERRLCIQAEHIRSQN
VIIKTREDKYHSKIKALEILVNGTNEENQMAINRLQIIKEEKSKIEEKRKLGEQDVARLM
KEKEISENTIASLKKEMEVMTSMHEQQLQKIELTAKQMEEHLTTKIKEVESLLVQSNKKI
EEVEAASLLKSQLWNKKEGIFQKYMNSQQLYVKGLRISSWSIKNEMHALEMELRDEMSNF
GSGLKCLVDAAENYHKVLAENQKLFNEVQELKGNIRVYCRVRPFLPGQDKKSTTVDYIGE
NAEVFSDIQPLIRSVLDGFNVCIFAYGQTGSGKTYTMSGPSTSKQDWGVNYRALNDLFDI
SLSRRNAFSYEVGVQMVEIYNEQANRAVGSTALNERSSRSHSILTVHVRGLDVKNGSTSR
GCLHLIDLAGSERVERSEATGDRLKEAQHINKSLSALGDVIFALAQKNAHVPYRNSKLTQ
VLQSSLGGQAKTLMFVQINPDVESYSETISTLKFAERVSGVELGAARSNKEGKDIKELLE
QVASLKDTIVRKDTEIEQLQLMKDKVKSPSFAVNINGASMPKNSNSDLRSVLSITTNQQS
QLSDPQSYAEVNRDGGPTSYTDITPTCLDEADFEDNASEDGFSGGTDYSVGCAAGASVFP
NSCSDRTADTSMYSHLPISLTPN
Download sequence
Identical sequences OsIBCD019933 39946.BGIOSIBCE021241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]