SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD020665 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD020665
Domain Number 1 Region: 69-150
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000155
Family PDI-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD020665
Sequence length 170
Comment 170
Sequence
MGPFEEVVGKVDGGERREGGELGREVASECGCEEVEGEEEDKVAGEEEVGAYYTGYPKDL
GPSRIIPFTCTYTQHLDKVLEEAAATFHPHVKFVRVECPKYPGFCLTRQKNEYPFIEVFY
NPEQAASPGKVVDPNVTKYSVKVLPFNYDQSMYGFREYFKKHGFKYFETN
Download sequence
Identical sequences 39946.BGIOSIBCE021925 OsIBCD020665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]