SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD023229 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD023229
Domain Number 1 Region: 151-435
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.39e-37
Family G proteins 0.059
Further Details:      
 
Domain Number 2 Region: 962-1073
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-28
Family Thioltransferase 0.00053
Further Details:      
 
Domain Number 3 Region: 537-890
Classification Level Classification E-value
Superfamily L domain-like 3.06e-19
Family Internalin LRR domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD023229
Sequence length 1077
Comment 1077
Sequence
MMESPPTVCYSMGTINSLVEKITPLLENHPMMEDLLQDVKSLREDLMNKFAAGGRASGGE
RVKVWMKQVREMVYDMEDWIDLKLQEEGANLSQSDKPRMDGFRSLIQDARGRCERYELLE
RAAAATANSDAEAGRPGEVAGGRLLWEEKTVLLGIDAPKSELLNHLSSEQKELKVVSILG
AGAHGKTALSREIYRDICTTKQFECQAFVSVGRTTSTRTALIELLRQVKSDTNAPQSRSY
NDEKQVSEIITELFRFLKTKRYFICIDDIRSTQDSESITCALPDNNLGSRILTTSRMKDI
AKLCSRRPSDVVYEMMSLGEDNTRSLFLNNVYVQEEEWPDHFKESSKKLFKVCGDVPFAI
IITAGLLGRTSAELSARSDRLTKTILSELSARSERLTKTILSELDQFDSAPQVMGKILDI
SYGDLPLPLKSCFLYMAAFIGNHGIIKRGRLIQRWVAEGLIPERHGKSSLETGASYFDEL
ISRRLIQPAFDDNDDQPIGCTVHGVVADFVASLSTEENFITMGAELKSGGLFPCDRVRRV
SLDYSGEDEADTSFSTTYCLLEQKSWVCSDEKPSSDIDEAISLHLSRVRSLAFLGDATRI
PDVSALKHMRVLDLEDTKGLENKHLGSIGQLSLLRYLGLCGTNVTVLPPEVMALKQLTTL
NLRQTRVKRLPKFGDTKLVSLLAHQLTILPRGMGVMAELEELSEVLVGQDGSHAGDVARL
IAELGQLRMLGVRFGRLFNNQETDRRGVKHLLEEMAKSNLQSLLLDNYLHHLLDLLIASW
AKKRPQYLRKFELRIPGCLPLVPPDIGSLIALTHLHIHVEAVEPQPVHALGCLPNLVVLR
LELSTDPTLTVCGTDGFQCLKVFWYGGGGNGIGLRFEVGAMPQLRRLRLDLDAREAMLNY
GHLQFGIQHLPCLVHVHAIIQCKDASAGTEVDGMEAFIRDQVSLNPNDPVLEINTRVQRS
VAKAAEGAVIAIHNREGWMNQIDPDKLMVVDFSTSWCPASRRMAPVFADLAKMYPNVVFL
TVDVDDNDEMSTVAKQFGVNGVPTFLFMKGGYVQDRVVGAEKEELEEKLQEHAALML
Download sequence
Identical sequences B8B5P0
39946.BGIOSIBCE024591 OsIBCD023229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]