SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD023586 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD023586
Domain Number 1 Region: 83-245
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.27e-36
Family PAPS reductase-like 0.0034
Further Details:      
 
Domain Number 2 Region: 317-430
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.63e-23
Family PDI-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD023586
Sequence length 432
Comment 432
Sequence
MASATASISSHSVALRDLKAARIGAVKQQVAAAPAAGTAAARAQRARAEYYKSKTGHVGF
VGDGKGNAKPVISARFNEPGHSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYQLFDK
VEKHYGIRIEYMFPDAGEVQALVRAKGLFSFYEDGHQECCRARKVRPLRRALRGLRAWIT
GQRKDQSPGTRAAIPVVQVDPSFEGLAGGAGSLVKWNPVANVDGKDVWTFLRAMDVPVNA
LHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIDDQGGAAAAAAHKA
GGANGNGSAGAPDIFESSGVVSLTRAGVENLLRLESRAEPWLVVLYAPWCPFCQAMEASY
LELAERLGGAGGGVKVGKFRADGEQKAFAQQELQLQSFPTILLFPSRTARPIKYPSEKRD
VDSLLAFVNSLR
Download sequence
Identical sequences A2YLQ3
OsIBCD023586 39946.BGIOSIBCE024917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]