SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD023680 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD023680
Domain Number 1 Region: 137-260
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.21e-25
Family PDI-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD023680
Sequence length 459
Comment 459
Sequence
MISSSKLKSVDFYRKIPRDLTEASLSGAGLSIVAALAMVFLFGMELSNYLAVNTSTSVIV
DRSSDGEFLRIDFNLSFPALSCEFASVDVSDVLGTNRLNITKTVRKYSIDRNLVPTGSEF
HPGPIPTVSKHGDDVEENHDDGSVPLSSRNFDSYSHQYPVLVVNFYAPWCYWSNRLKPSW
EKTAKIMRERYDPEMDGRIILAKVDCTEEIDLCRRHHIQGYPSIRIFRKGSDLKENQGHH
DHESYYGDRDTESLVAAMETYVANIPKDAHVLALEDKSNKTVDPAKRPAPLTSGCRIEGF
VRVKKVPGSVVISARSGSHSFDPSQINVSHYVTQFSFGKRLSAKMFNELKRLTPYVGGHH
DRLAGQSYIVKHGDVNANVTIEHYLQIVKTELVTLRSSKELKLVEEYEYTAHSSLVHSFY
VPVVKFHFEPSPMQVAGILDSIFHNTLRLVKKVELGKNI
Download sequence
Identical sequences 39946.BGIOSIBCE025013 OsIBCD023680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]