SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD024324 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD024324
Domain Number 1 Region: 67-281
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.71e-65
Family Glutathione peroxidase-like 0.000000954
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD024324
Sequence length 283
Comment 283
Sequence
MQHAVATPLHTDQLHSPHSSPIKMLRSHSSLQCLRLDTFALQQLISFFFVSAPSAKAAQS
FVAMPGLTIGDTVPNLELDSTHGKIRIHDFVGDTYIILFSHPGDFTPVCTTELAAMAGYA
KEFDKRGVKLLGISCDDVQSHKDWIKDIEAYKPGNRVTYPIMADPSREAIKQLNMVDPDE
KDSNGGHLPSRALHIVGPDKKVKLSFLYPSCVGRNMDEVVRAVDALQTAAKHAVATPVNW
KPGERVVIPPGVSDDEAKEKFPQGFDTADLPSGKGYLRFTKVG
Download sequence
Identical sequences 39946.BGIOSIBCE025757 OsIBCD024324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]