SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD024461 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD024461
Domain Number 1 Region: 70-375
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0002
Further Details:      
 
Domain Number 2 Region: 422-512
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.16e-23
Family Thioltransferase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD024461
Sequence length 514
Comment 514
Sequence
MAVTRLAVAAALSAAPPSSRRRRAFFHHSCRPLPSSAVAAKALRASAAPAVDEEAPASPP
PSDLGKGVENLVIIGSGPAGYTAAIYAARANLKPVVFEGYQVGGVPGGQLMTTTEVENFP
GFPDGVTGPDLMDKMRKQAERWGAELHQEDVEFVNVKSRPFVIRSSDREVKCHSVIIATG
AAAKRLRLPREDEFWSRGISACAICDGASPLFKGQVLAVVGGGDTATEEAIYLTKYARHV
HLLVRKDQLRASKAMQDRVLSNPNITVHFNTEAVDVVSNPKGQMSGIQLKRTDTGEESVL
EVKGLFYGIGHTPNSQLLQGQIDLDDAGYILVEEGTAKTSVDGVFAAGDVQDHEWRQAVT
AAGSGCVAALSVERYLVANDLLVEFHQPVREEKEKEITDRDVEMGFDISHTKHRGQYALR
KVYHESPRLVCVLYTSPTCGPCRTLKPILSKVIDEYNEHVHFVEIDIEEDPEIAEAAGIM
GTPCVQFFKNKEMLRTVSGVKMKKEYREFIESNK
Download sequence
Identical sequences A0A0E0ANR2 B8B5I4
OsIBCD024461 OGLUM07G24990.1 39946.BGIOSIBCE025897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]