SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD026496 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD026496
Domain Number 1 Region: 90-182
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000005
Family PDI-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD026496
Sequence length 274
Comment 274
Sequence
MAAATASASASASAAAFLLLPLLAAAATAGHGVCPRQPAAAAVLPRQAPAASSSSSSSSC
PAAGSPGHRAHHVGVVEGDDFVLQKAVTLVLQNREDFVAILFYASWCPFSKIFRTDFQKL
SSFFPTIAHFSFEESRIKPRMLSRYGVRAFPTLFLVNSTMRVRYHGSRTMNSLAMFYKDV
TGMNPVSLDAISLERMEEAVNIIENDKKTEQGDSLFMFARSPDRLLHQDTCLALASSFVL
MRLLCFLLPKLNACVKQAWRMQFYELKRLFPSLS
Download sequence
Identical sequences B8BAR9
OsIBCD026496 39946.BGIOSIBCE027855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]