SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD027338 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD027338
Domain Number 1 Region: 90-222
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 6.82e-32
Family Glutathione S-transferase (GST), C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 19-85
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000654
Family Glutathione S-transferase (GST), N-terminal domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD027338
Sequence length 1254
Comment 1254
Sequence
MAGLSTGAGAPVVKLYHEKSMIMPDVSRVLACLYEKNIEFETVKDSYKDILRLQASRSVP
VPFYDGPTFLQESRAICRYIAETYEQRGYPFLLGKDVLERASIEQWLRHEEHAFDPPSRA
LFCHLAFPVQDDDDDDINTEKRKLEEVLEVYEQRLGESEFLAGNKFTLADLVHLPNTHHL
VTSEFAYLYDSRKNVQRWWDTISNRQSWKQVLKDMNRVEEEYQMELEQQEEQWQTELPQT
SVGHTIHLDPRQTTSTESRTVLVPPPSAGMISTSFSSQREQPLPSETTRQDKPSPRKESN
FFTTTEKTPSTPRSRAPTTQKQPSSTFFTPSTTPKIPQRTDTDISSSKDAPYQTKPSETT
SKEAHDKSHLSGFFKARSHTDETATPTKHSPQEDSKTSTKIPKTRDISEALGPNSPISTK
APHEIDERASVDPRFDKPAPYTKPTTNIPQTSSGRPSAQRDLGTSPGTEADKTSSDLGGG
VQSPYAQGRAEQVKKTSSDQRGSETAQPAQPRGTQQFTKDARQADQNRIAASPRQQPSES
QEDTHNIMSEDERFSTKRLRKMMEESEKEAQEVKSQPTDFRPSKEETPSIYKNPSDVQDR
TILDDRKSGRSPSAGTRAPDYPTSAAERRVASQPKEGMPYDDRGATKPQKSPSINEQEKI
PVVPSQAPPASSGKASESLKEVSPDDGLAQVSTINQWRQTSAPPPTKLAAPDAPRNVELA
KTEGVDKRTQPSTTKETPRNDRNVLATGQGADRGVGNEQYDKNSIDERAPQMTPRQAAPS
VTQRASASIQERISGARGASDDMFGKTSSADQSNTPAIPKQTTVQGATPDVRGTSYADRE
MKLPADEKATANKQKPVSSSQQTIEPIRGGTPTSYGSTDDDLAKTSRANERQTPPSKAQA
PASNRQSASTALQGGTPDARGENTAVKPSVTSPTGMPTSSRRQEPTPSVTSPTGVPTSPR
RQEPTPDTQRRRAADQMPSQAPLPSSFSTRNKENGIFEAGQTNTVAPDGLPGPGVPKDAG
PQVAGPSVVKSQKNMNEAYNDGPSTQQLPNDQYRSQPREAKEEQGADAALINEIGKAQKD
DLLANPNQSSTGRVQPTSTEETSKQQLQSGLNKPISSKDGKETVSYGSSATSREMLPSIP
DKSMRVQQPQGDKSSYSSISQEDNVKQGSQAALQGSGNEQPKKRDLLANADEKIRGTTGE
ALQKSDEGRISSNTEQMKSNRNNSKPDGSTEPTSFDGNEGNLPESQRRGSSSNP
Download sequence
Identical sequences A2YXV7
OsIBCD027338 39946.BGIOSIBCE028786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]