SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD027396 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD027396
Domain Number 1 Region: 312-504
Classification Level Classification E-value
Superfamily Ribosomal protein L1 3.92e-60
Family Ribosomal protein L1 0.00012
Further Details:      
 
Domain Number 2 Region: 96-216
Classification Level Classification E-value
Superfamily Ribosomal protein L1 1.05e-34
Family Ribosomal protein L1 0.00067
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000165
Family Thioltransferase 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD027396
Sequence length 504
Comment 504
Sequence
MTSVEHDARGLISDDKHGRKVKESSKIGQCPRPEKPIEIYEFEGCPFCRKVREMVAVLDL
DVLFYPCPKNGPTFRPKVLEMGGKQQFPYMSEVLKEAISQVVGESKEKGRKFTETVELQI
GLKNYDPQKDKRFSGSVKLPHIPRPKMKVCMLGDAQHVEEAEKIGLDYMDVEALKKMNKN
KKLVKKLAKKYHAFLASEAIIKQIPRLLGPGLNKAGNAHRYCCCVSFFLSGLLGEQKMER
ERMEKRKKKLEKEKAEADKGNPAASDKPQGHSEIATLRVCLKRLSVVELSAANMSKLQTE
ALKEAISQVVADCKEKNRKFTETVELQIGLKNYDPQKDKRFSGSVKLSHIPRPKMKVCML
GDAQHVEEAEKIGLDYMDVEALKKMNKNKKLVKKLAKKYHAFLASEAIIKQIPRLLGPGK
FPTLVTHQESLESKVNETKATVKFQLKKVLCMGVAVGNLSMEEKQIQQNIQMSVNFLVSL
LKKNWQNVRCLYIKSTMGKPYRVF
Download sequence
Identical sequences OsIBCD027396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]