SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD028492 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD028492
Domain Number 1 Region: 207-341
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.12e-31
Family Thioltransferase 0.00034
Further Details:      
 
Domain Number 2 Region: 111-177
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000849
Family Tetratricopeptide repeat (TPR) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD028492
Sequence length 344
Comment 344
Sequence
MAEDESASWFQYPEEMLPPTPFSTTPAVAAKAVDMATAGASSFEDEIMESDIELEGEAVE
PDNDPPQKMGDPSVEVSDEKRDQAQLCKNKGVDAFSEGKVCNKLVFPLNQYGFVYKQSIS
LYQSKKPNAAIRDADAALKINPDSAKGYKSRGMAKAMLGKWEEAAQDLRMAAKLDYDEEI
GAELKKVEPNVLKIEEHRKKYERLRKERDIKKAEMEKQRKHAEEVSAASAALKDGDVIAI
HSSSELDTKLKAASSLSRLVVLYFTAAWCGPCRFIGPVCKSLAEKHRNVVFLKVDIDELN
SVAYRWNVSSVPSFFFVRNGKEIDKVVGADKNGLERKVAQHGSS
Download sequence
Identical sequences OsIBCD028492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]