SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD028590 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD028590
Domain Number 1 Region: 154-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000253
Family Classic zinc finger, C2H2 0.044
Further Details:      
 
Domain Number 2 Region: 102-141
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000238
Family HkH motif-containing C2H2 finger 0.044
Further Details:      
 
Domain Number 3 Region: 258-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000277
Family Classic zinc finger, C2H2 0.067
Further Details:      
 
Domain Number 4 Region: 200-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000158
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 5 Region: 299-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000187
Family HkH motif-containing C2H2 finger 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD028590
Sequence length 339
Comment 339
Sequence
MADKNVDFKTDIPYTGDSLVVVRDALLSQLQQDRLRKDIIVAELAKIERAMALRDVSQSP
TPRHAAAAAAAGKTITTVLHIKQATPAKKPSPSEKSEPAVQKSMPPSAWSCAVCQVRTTS
ERNLRDHCGGQKHQSKVAALEKTTKAMARTTAKPSPGAAARWGCSICNISCNGEWDFDTH
LKGKKHQANTQALLEQSKKSSVNPESQGTKAAAATLICRVCQAKFTCQSDLQSHLKVMRH
QLNLRAPSSDGSSFTSATSESLSLELYSCKVCSVKCTGERMLAYHLTGKKHLKQENLQLS
CEICKLQCNSEKVLSDFRYGKKHQAKLEKVLQAKLNATV
Download sequence
Identical sequences OsIBCD028590 39946.BGIOSIBCE029971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]