SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029274 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029274
Domain Number 1 Region: 54-225
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000323
Family DsbC/DsbG C-terminal domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029274
Sequence length 237
Comment 237
Sequence
MARPRAPLLRRMLLLCAVAASCSYYLLVLHAQASVPPRYDGFAYGDAATAAWKDTILVEA
FLDPLCPDSRDAWAPLRLAVDRYAPRVSLIVHPFPLPYHTNSFLACRALYIANKLNSSST
YPLLELFFKSQGKFYNAATSSLSSTVISGEMSKLAARVVGNSVSEFQSGFSDIRTDLAAR
VSFKYGCTRGVAGAPFFFVNGFLQPGGGSPIDYSTWVSILDPLAGQHGDKLEMFTSM
Download sequence
Identical sequences A0A0E0IN31 B8BE24
ONIVA09G19320.1 OsIBCD029274 39946.BGIOSIBCE030754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]