SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD029409 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD029409
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.42e-20
Family Thioltransferase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD029409
Sequence length 109
Comment 109
Sequence
MTIDSWQQLIDSLKGNVVVLEFMAPWSEPSKFMEQPFKEVASEFKDKNSNVKFAALNFDN
SKNLARRLQVEALPTFLVVNNFAVVDRILALSKTELQQKINDKLAQTNY
Download sequence
Identical sequences A0A0D3HA30 B8BEL0
OsIBCD029409 39946.BGIOSIBCE030926 OBART09G19710.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]