SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030188 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030188
Domain Number 1 Region: 2-55
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000126
Family Thioltransferase 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030188
Sequence length 131
Comment 131
Sequence
MDPRYLQELGALLPRARGVTLPQVFVGGRHLGGAEEVRRLHESGELRRVVAGAGATALAA
CSQCGGERYVLCGSCNGSHKRYSLKEATTSTIGREDIRVSEDCNMIGKEILIGCNGGHIT
ITSDNDVAGTI
Download sequence
Identical sequences A2Z673
OsIBCD030188 39946.BGIOSIBCE031662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]