SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OsIBCD030464 from Oryza sativa ssp. Indica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OsIBCD030464
Domain Number 1 Region: 92-237
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.51e-31
Family Glutathione S-transferase (GST), C-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 11-118
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.94e-20
Family Glutathione S-transferase (GST), N-terminal domain 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OsIBCD030464
Sequence length 244
Comment 244
Sequence
MAAAAEEGEGVRLLGGRMSPFTMRARMALALRGVEYELVEEALHPRKSGRLLAANPAYGR
IPVLLLPGGRAVCESAVIAQYVDDAWGGAGAGAAILPVDPYERAMHRFWTAYIDDKFWPA
LDAISLAPTPEARATATASTRAALKLLEEAFAARSNGGAFFSGGGAAASPGLLDVALGCF
LPALWACESLNGLRLLDDDATPLLRAWSARLAATPAAMAVMPETEEVVAFTRFLQTKFGV
AGSK
Download sequence
Identical sequences A0A0E0BA35 A0A0E0IRS4 A2Z6X8
OsIBCD030464 39946.BGIOSIBCE031896 OGLUM10G08670.1 ONIVA10G08500.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]